.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o57

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a putative sarcosine dimethylglycine methyltransferase from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 2o57 Target Id GO.80048
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS30222, Molecular Weight 33321.90 Da.
    Residues 297 Isoelectric Point 5.86
    Sequence mrvensngqsqpaatsktvkdnaeiyydnddsdrfyfhvwggedihvglykepvdqdeireaslrtdew laselamtgvlqrqakgldlgagyggaarflvrkfgvsidclniapvqnkrneeynsqagladnitvky gsfleipcednsydfiwsqdaflhspdklkvfqecarvlkpggvmaitdpmkedgidkssiqpildrik lhdmgslglyrslakecglvtlrtfsrpdslvhhyskvkaelikrsseiasfcspefqanmkrglehwi eggragkltwggmlfrksdki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.221
    Matthews' coefficent 2.30 Rfactor 0.166
    Waters 1042 Solvent Content 46.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2o57

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch