.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o55

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a putative glycerophosphodiester phosphodiesterase from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 2o55 Target Id GO.80034
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS30332, Molecular Weight 29914.93 Da.
    Residues 261 Isoelectric Point 5.42
    Sequence mskviipkivghrgvgkeglapentlrsfvlcmernipyietdlrvcktgeivlfhgtpegtipfykdg tsrigdlsleelkrldvggghtipsleelfvaieeqkfnlklnlelkgeewkrkesgdhqrllllveky hmqervdycsfhhealahlkalcpdvkitylfnymgqptpldfveqtqkacygdangvsmlfhyltkeq vctahekglsvtvwmpwifddseedwkkclelqvdlicsnypfglmnflsnise
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.81 Rfree 0.255
    Matthews' coefficent 2.70 Rfactor 0.192
    Waters 1 Solvent Content 53.50

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2o55

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch