The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an Unknown Protein from Galdieria sulphuraria. To be Published
    Site CESG
    PDB Id 2nyi Target Id GO.80004
    Molecular Characteristics
    Source Galdieria sulphuraria
    Alias Ids TPS30256, Molecular Weight 21096.39 Da.
    Residues 195 Isoelectric Point 4.37
    Sequence metqsfvvsvagsdrvgivhdfswalknisanvessrmaclggdfamivlvslnakdgkliqsalesal pgfqistrrassvaerhvspdtreyelyvegpdsegiveavtavlakkganiveletetlpapfagftl frmgsrvafpfplyqevvtalsrveeefgvdidleevvegedseedddspnspvgrh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.214
    Matthews' coefficent 2.68 Rfactor 0.176
    Waters 378 Solvent Content 54.16

    Ligand Information


    Google Scholar output for 2nyi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch