.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nxf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393. To be Published
    Site CESG
    PDB Id 2nxf Target Id GO.70653
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30218, Molecular Weight 36642.92 Da.
    Residues 322 Isoelectric Point 5.43
    Sequence medpvftfgliadvqyadiedgenylrtrrryyrgsadllrdavlqwrrervqcvvqlgdiidghnrrr dasdraldtvmaeldacsvdvhhvwgnhefynfsrpsllssrlnsaqrtgtdtgsdligddiyayefsp apnfrfvlldaydlsvigreeesekhthswriltqhnhnlqdlnlppvsvgleqrfvkfnggfseqqlq wldavltlsdhkqervlifshlpvhpcaadpiclawnheavlsvlrshqsvlcfiaghdhdggrctdss gaqhitlegvietpphshafataylyedrmvmkgrgrvedltitys
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.18
    Matthews' coefficent 3.00 Rfactor 0.161
    Waters 359 Solvent Content 57.40

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EOH (ETHANOL) x 1
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2nxf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch