The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR. Febs J. 275 5873-5884 2008
    Site CESG
    PDB Id 2jz4 Target Id GO.12798
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30262,15607 Molecular Weight 32021.09 Da.
    Residues 300 Isoelectric Point 5.06
    Sequence maqkveagggaggaswddgvhdgvrkvhvgqgqdgvssinvvyakdsqdveggehgkktllgfetfevd addyivavqvtydnvfgqdsdiitsitfntfkgktsppygletqkkfvlkdknggklvgfhgragealy algayfattttpvtpakklsaiggdegtawddgaydgvkkvyvgqgqdgisavkfeynkgaenivggeh gkptllgfeefeidypseyitavegtydkifgsdgliitmlrfktnkqtsapfgleagtafelkeeghk ivgfhgkasellhqfgvhvmpltn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2jz4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch