The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for RNA recognition by a type II poly(A)-binding protein. Proc.Natl.Acad.Sci.USA 105 15317-15322 2008
    Site CESG
    PDB Id 2jwn Target Id GO.80182
    Molecular Characteristics
    Source Xenopus laevis
    Alias Ids TPS30197,15528 Molecular Weight 13277.22 Da.
    Residues 121 Isoelectric Point 7.28
    Sequence pcmqtthskmtagaytegppqplsaeekkeidkrsvyvgnvdygstaqdleahfsscgsinritilcdk fsghpkgyayiefaernsvdaavamdetvfrgrtikvlpkrtnmpgisstdr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information


    Google Scholar output for 2jwn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch