The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Intrinsically disordered gamma-subunit of cGMP phosphodiesterase encodes functionally relevant transient secondary and tertiary structure. Proc.Natl.Acad.Sci.USA 105 1505-1510 2008
    Site CESG
    PDB Id 2ju4 Target Id GO.81782
    Molecular Characteristics
    Source Bos taurus
    Alias Ids TPS30232, Molecular Weight 9668.76 Da.
    Residues 87 Isoelectric Point 9.51
    Sequence mnleppkaeirsatrvmggpvtprkgppkfkqrqtrqfkskppkkgvqgfgddipgmeglgtditvicp weafnhlelhelaqygii
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ju4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch