.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ifu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and dynamics of gamma-SNAP: insight into flexibility of proteins from the SNAP family. Proteins 70 93-104 2008
    Site CESG
    PDB Id 2ifu Target Id GO.79361
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30323, Molecular Weight 33945.61 Da.
    Residues 305 Isoelectric Point 5.45
    Sequence maqkiseahehiakaekylktsfmkwkpdydsaaseyakaavafknakqleqakdaylqeaeahannrs lfhaakafeqagmmlkdlqrmpeavqyiekasvmyvengtpdtaamaldragklmepldlskavhlyqq aaavfeneerlrqaaeligkasrllvrqqkfdeaaaslqkeksmykemenyptcykkciaqvlvqlhra dyvaaqkcvresysipgfsgsedcaaledllqaydeqdeeqllrvcrsplvtymdndyaklaislkvpg ggggkkkpsasasaqpqeeeddeyagglc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.261
    Matthews' coefficent 3.61 Rfactor 0.239
    Waters 64 Solvent Content 66.30

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals

    Jmol

     
    Google Scholar output for 2ifu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch