.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of two Arabidopsis thaliana major latex proteins represent novel helix-grip folds. Proteins 76 237-243 2009
    Site CESG
    PDB Id 2i9y Target Id GO.74365
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30242, Molecular Weight 17527.91 Da.
    Residues 157 Isoelectric Point 5.14
    Sequence teasslvgkletdveikasadkfhhmfagkphhvskaspgniqgcdlhegdwgtvgsivfwnyvhdgea kvakerieavepdknlitfrviegdlmkeyksflltiqvtpkpggpgsivhwhleyekiseevahpetl lqfcvevskeidehllaee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i9y

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch