.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i5t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Homo sapiens protein LOC79017. Proteins 70 588-591 2008
    Site CESG
    PDB Id 2i5t Target Id GO.35223
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30309, Molecular Weight 21006.67 Da.
    Residues 188 Isoelectric Point 5.07
    Sequence mansgckdvtgpdeesflyfaygsnllterihlrnpsaaffcvarlqdfkldfgnsqgktsqtwhggia tifqspgdevwgvvwkmnksnlnsldeqegvksgmyvvievkvatqegkeitcrsylmtnyesappspq ykkiicmgakenglpleyqeklkaiepndytgkvseeiediikkgetqtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.01 Rfree 0.234
    Matthews' coefficent 2.20 Rfactor 0.183
    Waters 141 Solvent Content 42.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i5t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch