The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an eIF4G-like protein from Danio rerio. Proteins 78 1803-1806 2010
    Site CESG
    PDB Id 2i2o Target Id GO.79294
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30356, Molecular Weight 25763.17 Da.
    Residues 222 Isoelectric Point 5.08
    Sequence mensskedykiqsfdletqkllktalkdpgsvdlekvssvivdqslkdqvfsreagricytivqaeakq tngsvfrrnllnrlqqefkareetrkrstqewvclvsficnifdylkvnnmpmvalvhpvydclfrlaq sdalkneeevdclvlqlhrigdqlekmnvqlmdelfnllrdgfllqedlssmgrlllleilefraggwk lsdtaqkyyysevtd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.92 Rfree 0.235
    Matthews' coefficent 2.70 Rfactor 0.19
    Waters 418 Solvent Content 52.00

    Ligand Information
    Metals NI (NICKEL) x 2


    Google Scholar output for 2i2o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch