.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ho4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Protein from Mouse Mm.236127. To be published
    Site CESG
    PDB Id 2ho4 Target Id GO.34556
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30165, Molecular Weight 28742.62 Da.
    Residues 259 Isoelectric Point 5.70
    Sequence maarralkavlvdlngtlhiedaavpgaqealkrlratsvmvrfvtnttketkkdllerlkklefeise deiftsltaarnlieqkqvrpmllvddralpeftgvqtqdpnavviglapehfhyqllnqafrllldga pliaihkaryykrkdglalgpgpfvtaleyatdtkamvvgkpektfflealrdadcapeeavmigddcr ddvdgaqnigmlgilvktgkykaadeekinpppyltcesfphavdhilqhll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.282
    Matthews' coefficent 2.60 Rfactor 0.224
    Waters 133 Solvent Content 53.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 6
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2ho4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch