.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Glyoxylate/Hydroxypyruvate reductase from Homo sapiens. To be Published
    Site CESG
    PDB Id 2h1s Target Id GO.37540
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30177, Molecular Weight 35666.24 Da.
    Residues 328 Isoelectric Point 7.01
    Sequence mrpvrlmkvfvtrripaegrvalaraadceveqwdsdepipakelergvagahgllcllsdhvdkrild aaganlkvistmsvgidhlaldeikkrgirvgytpdvltdttaelavslllttcrrlpeaieevknggw tswkplwlcgygltqstvgiiglgrigqaiarrlkpfgvqrflytgrqprpeeaaefqaefvstpelaa qsdfivvacsltpateglcnkdffqkmketavfinisrgdvvnqddlyqalasgkiaaagldvtspepl ptnhplltlkncvilphigsathrtrntmsllaannllaglrgepmpselkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.45 Rfree 0.2643
    Matthews' coefficent 2.58 Rfactor 0.2072
    Waters 450 Solvent Content 52.41

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2h1s

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch