The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of aspartoacylase, the brain enzyme impaired in Canavan disease. Proc.Natl.Acad.Sci.Usa 104 456-461 2007
    Site CESG
    PDB Id 2gu2 Target Id GO.59616
    Molecular Characteristics
    Source Rattus norvegicus
    Alias Ids TPS30246, Molecular Weight 35311.67 Da.
    Residues 312 Isoelectric Point 5.95
    Sequence mtscvaeepikkiaifggthgneltgvflvthwlkngaevhraglevkpfitnpravekctryidcdln rvfdlenlskemsedlpyevrraqeinhlfgpknsddaydvvfdlhnttsnmgctliledsrndfliqm fhyiktcmaplpcsvyliehpslkyattrsiakypvgievgpqphgvlradildqmrrmlkhaldfiqr fnegkefppcaidvykimekvdyprnesgdvaavihpnlqdqdwkplhpgdpvfvsldgkviplggdct vypvfvneaayyekkeafakttkltlnaksirstlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.194
    Matthews' coefficent 2.33 Rfactor 0.1494
    Waters 552 Solvent Content 47.27

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals ZN (ZINC) x 2


    Google Scholar output for 2gu2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch