The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens. Protein Sci. 16 1479-1484 2007
    Site CESG
    PDB Id 2gow Target Id GO.35156
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30340, Molecular Weight 13156.36 Da.
    Residues 117 Isoelectric Point 6.27
    Sequence mssnvpadminlrlilvsgktkeflfspndsasdiakhvydnwpmdweeeqvsspnilrliyqgrflhg nvtlgalklpfgkttvmhlvaretlpepnsqgqrnrektgesnccvil
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2gow

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch