The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The First Structure from the SOUL/HBP Family of Heme-binding Proteins, Murine P22HBP. J.Biol.Chem. 281 31553-31561 2006
    Site CESG
    PDB Id 2gov Target Id GO.79130
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30292, Molecular Weight 21293.07 Da.
    Residues 193 Isoelectric Point 5.18
    Sequence mlgmirnslfgsvetwpwqvlstggkedvsyeeraceggkfatnullevtdkpvdealreampkimkyv ggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesvkieeregitvystqf ggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpygrrnevwlvka
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2gov

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch