.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gnx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of a hypothetical protein from Mouse Mm.209172. To be Published
    Site CESG
    PDB Id 2gnx Target Id GO.34351
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30254, Molecular Weight 50252.99 Da.
    Residues 445 Isoelectric Point 9.10
    Sequence mgesiplaapvpveqavletffshlgifsydkakdnvekereanksaggswlsllaalahlaaaekvyh sltylgqklggqsffsrkdsirtiytslhnelkkvvagrgapggtaphveellphlseqlcffvqarme iadfyekmyalstqkfinteelvstldtilrkyssrfhhpilsplessfqlevgvlshllkaqaqisew kflpslvtlhnahtklqswgqtfekqretkkhlfggqsqkavqpphlflwlmklktmllakfsfyfhea lsrqttasemkaltakanpdlfgkissfirkydaanvslifdnrgsesfqghgyhhphsyreapkgvdq ypavvslpsdrpvmhwpnvimimtdrasdlnslekvvhfyddkvqstyfltrpephftivvifeskkse rdshfisflnelslalknpkvfaslkpgskg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.45 Rfree 0.322
    Matthews' coefficent 2.72 Rfactor 0.281
    Waters 25 Solvent Content 54.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gnx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch