The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for catalysis by onconase. J.Mol.Biol. 375 165-177 2008
    Site CESG
    PDB Id 2gmk Target Id GO.80161
    Molecular Characteristics
    Source Rana pipiens
    Alias Ids TPS30294, Molecular Weight 11799.00 Da.
    Residues 104 Isoelectric Point 9.09
    Sequence qdwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvlttsefylsdcn vtsrpckyklkkstnkfcvncanqapvhfvgvgsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.2173
    Matthews' coefficent 2.12 Rfactor 0.1653
    Waters 196 Solvent Content 41.88

    Ligand Information
    Ligands AMP (ADENOSINE) x 4


    Google Scholar output for 2gmk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch