.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gcu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an ETHE1-like protein from Arabidopsis thaliana. ACTA CRYSTALLOGR.,SECT.D 62 964-970 2006
    Site CESG
    PDB Id 2gcu Target Id GO.4980
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30313, Molecular Weight 27872.07 Da.
    Residues 256 Isoelectric Point 5.45
    Sequence mgssssfssssskllfrqlfenesstftylladvshpdkpallidpvdktvdrdlklidelglkliyam nthvhadhvtgtgllktklpgvksviskasgskadlflepgdkvsigdiylevratpghtagcvtyvtg egadqpqprmaftgdavlirgcgrtdfqegssdqlyesvhsqiftlpkdtliypahdykgfevstvgee mqhnprltkdketfktimsnlnlsypkmidvavpanmvcglqdvpsqan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.48 Rfree 0.2037
    Matthews' coefficent 2.43 Rfactor 0.1765
    Waters 1037 Solvent Content 49.44

    Ligand Information
    Ligands SO4 (SULFATE) x 1;EDO (1,2-ETHANEDIOL) x 14
    Metals FE2 (FE) x 4

    Jmol

     
    Google Scholar output for 2gcu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch