.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g2b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the human allograft inflammatory factor 1. To be published
    Site CESG
    PDB Id 2g2b Target Id GO.33780
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30311, Molecular Weight 16702.43 Da.
    Residues 147 Isoelectric Point 5.98
    Sequence msqtrdlqggkafgllkaqqeerldeinkqflddpkyssdedlpsklegfkekymefdlngngdidims lkrmleklgvpkthlelkkligevssgsgetfsypdflrmmlgkrsailkmilmyeekarekekptgpp akkaiselp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g2b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch