The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of protein from Zebra Fish Dr.13312. To be Published
    Site CESG
    PDB Id 2fb7 Target Id GO.70875
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30288, Molecular Weight 9483.28 Da.
    Residues 85 Isoelectric Point 5.04
    Sequence msggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyiifrg sdikdltvceppkpim
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2fb7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch