The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of gene locus At3g16990 from Arabidopsis thaliana. Proteins 57 221-222 2004
    Site CESG
    PDB Id 2f2g Target Id GO.12240
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30149, Molecular Weight 25068.98 Da.
    Residues 221 Isoelectric Point 4.90
    Sequence mekrgvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlirackds gessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlmssevkypvimtafwa ieavyqesfahcledgnktpveltgachrwgndgfkqycssvkniaerclenasgevlgeaedvlvrvl elevafwemsrggq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.23355
    Matthews' coefficent 2.78 Rfactor 0.16979
    Waters 427 Solvent Content 55.50

    Ligand Information


    Google Scholar output for 2f2g

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch