The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Arabidopsis thaliana cytokinin dehydrogenase. Proteins 70 303-306 2008
    Site CESG
    PDB Id 2exr Target Id GO.29544
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30234, Molecular Weight 57972.53 Da.
    Residues 524 Isoelectric Point 5.02
    Sequence miayiepyflendaeaasaataagkstdgvseslniqgeilcggaaadiagrdfggmncvkplavvrpv gpediagavkaalrsdkltvaargnghsingqamaegglvvdmsttaenhfevgylsggdatafvdvsg galwedvlkrcvseyglaprswtdylgltvggtlsnagvsgqafrygpqtsnvteldvvtgngdvvtcs eienselffsvlgglgqfgiitrarvllqpapdmvrwirvvytefdeftqdaewlvsqknessfdyveg fvfvngadpvngwptvplhpdhefdptrlpqscgsvlyclelglhyrdsdsnstidkrverligrlrfn eglrfevdlpyvdfllrvkrseeiakengtwetphpwlnlfvskrdigdfnrtvfkelvkngvngpmlv ypllrsrwddrtsvvipeegeifyivallrfvppcakvssvekmvaqnqeivhwcvkngidyklylphy ksqeewirhfgnrwsrfvdrkamfdpmailspgqkifnrsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2139
    Matthews' coefficent 2.15 Rfactor 0.1712
    Waters 633 Solvent Content 42.69

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1


    Google Scholar output for 2exr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch