.
The Open Protein Structure Annotation Network
PDB Keyword
.

2evn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Arabidopsis thaliana At1g77540 Protein, a Minimal Acetyltransferase from the COG2388 Family. Biochemistry 45 14325-14336 2006
    Site CESG
    PDB Id 2evn Target Id GO.6042
    Related PDB Ids 2il4 1xmt 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30139,6338 Molecular Weight 11733.81 Da.
    Residues 103 Isoelectric Point 7.86
    Sequence mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafehasshs isiipscsyvsdtflprnpswkplihsevfkssi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2evn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch