.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ett

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of human sorting nexin 22. Protein Sci. 16 807-814 2007
    Site CESG
    PDB Id 2ett Target Id GO.33811
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30317,6866 Molecular Weight 14193.74 Da.
    Residues 120 Isoelectric Point 10.13
    Sequence mlevhipsvgpeaegprqspekshmvfrvevlcsgrrhtvprrysefhalhkrikklykvpdfpskrlp nwrtrgleqrrqgleayiqgilylnqevpkelleflrlrhfptdpkasnwg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ett

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch