The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Danio rerio secretagogin: A hexa-EF-hand calcium sensor. Proteins 76 477-483 2009
    Site CESG
    PDB Id 2be4 Target Id GO.74073
    Molecular Characteristics
    Source Danio rerio
    Alias Ids TPS30358, Molecular Weight 31576.49 Da.
    Residues 272 Isoelectric Point 5.39
    Sequence mdsafanldaagflqiwqhfdaddngyiegkelddffrhmlkklqpkdkitdervqqikksfmsaydat fdgrlqieelanmilpqeenfllifrreapldnsvefmkiwrkydadssgyisaaelknflkdlflqhk kkippnkldeytdammkifdknkdgrldlndlarilalqenfllqfkmdassqverkrdfekifahydv srtgalegpevdgfvkdmmelvrpsisggdldkfrecllthcdmnkdgkiqkselalclglkhkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2529
    Matthews' coefficent 2.30 Rfactor 0.1755
    Waters 240 Solvent Content 46.90

    Ligand Information


    Google Scholar output for 2be4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch