The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the mengovirus Leader protein zinc-finger domain. Febs Lett. 582 896-900 2008
    Site CESG
    PDB Id 2bai Target Id GO.79761
    Molecular Characteristics
    Source Mengovirus
    Alias Ids TPS14657,6863 Molecular Weight 3721.06 Da.
    Residues 32 Isoelectric Point 4.90
    Sequence mattmeqeicahsmtfeecpkcsalqyrngfy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2bai

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch