.
The Open Protein Structure Annotation Network
PDB Keyword
.

2atf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and mechanism of mouse cysteine dioxygenase. Proc.Natl.Acad.Sci.Usa 103 3084-3089 2006
    Site CESG
    PDB Id 2atf Target Id GO.35683
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30202, Molecular Weight 23024.71 Da.
    Residues 200 Isoelectric Point 5.98
    Sequence mertellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvdqgngk fnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksertlrenqcayindsig lhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhskfgirtpfttsgslenn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.21555
    Matthews' coefficent 2.20 Rfactor 0.17885
    Waters 188 Solvent Content 43.60

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 2atf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch