The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure at 1.6 Angstroms resolution of the protein product of the At4g34215 gene from Arabidopsis thaliana. Acta Crystallogr.,Sect.D 61 1655-1661 2005
    Site CESG
    PDB Id 2apj Target Id GO.22797
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30280, Molecular Weight 28356.70 Da.
    Residues 260 Isoelectric Point 5.63
    Sequence meggsitpgedkpeiqspippnqifilsgqsnmagrggvfkdhhnnrwvwdkilppecapnssilrlsa dlrweeaheplhvdidtgkvcgvgpgmafanavknrletdsaviglvpcasggtaikewergshlyerm vkrteesrkcggeikavlwyqgesdvldihdaesygnnmdrliknlrhdlnlpslpiiqvaiasgggyi dkvreaqlglklsnvvcvdakglplksdnlhltteaqvqlglslaqaylsnfc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.183
    Matthews' coefficent 2.30 Rfactor 0.1456
    Waters 1611 Solvent Content 46.80

    Ligand Information


    Google Scholar output for 2apj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch