.
The Open Protein Structure Annotation Network
PDB Keyword
.

2amy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure of Human Phosphomannomutase 2 (PMM2). To be Published
    Site CESG
    PDB Id 2amy Target Id GO.36653
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30307, Molecular Weight 28080.70 Da.
    Residues 246 Isoelectric Point 6.35
    Sequence maapgpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvvekydyvfp englvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefrngmlnvspigrscsq eeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvfpdgwdkryclrhvendgyktiyff gdktmpggndheiftdprtmgysvtapedtrricellfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.09 Rfree 0.272
    Matthews' coefficent 2.60 Rfactor 0.199
    Waters 142 Solvent Content 51.90

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;GLY x 3
    Metals

    Jmol

     
    Google Scholar output for 2amy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch