.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ab1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure of Gene Product from Homo Sapiens HS.95870. To be Published
    Site CESG
    PDB Id 2ab1 Target Id GO.33759
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30214, Molecular Weight 13331.56 Da.
    Residues 122 Isoelectric Point 8.58
    Sequence mtspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvekgvqtlvigr gmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.59 Rfree 0.257
    Matthews' coefficent 2.20 Rfactor 0.193
    Waters 104 Solvent Content 44.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ab1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch