.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a3q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure of Protein from Mus Musculus MM.29898. To be Published
    Site CESG
    PDB Id 2a3q Target Id GO.34455
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS30319, Molecular Weight 18793.88 Da.
    Residues 170 Isoelectric Point 4.93
    Sequence mstagdgergtvgqedsaaarpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelae lfqwksdtepgpqawppkeraalqeelsdvliylvalaarchvdlpqaviskmdtnrqrypvhlsrgsa ckytdlprgtisenqavgagdpaselrdqast
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.32 Rfree 0.239
    Matthews' coefficent 2.50 Rfactor 0.21
    Waters 24 Solvent Content 49.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a3q

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch