.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a3l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Membrane association, mechanism of action, and structure of Arabidopsis embryonic factor 1 (FAC1). J.Biol.Chem. 281 14939-14947 2006
    Site CESG
    PDB Id 2a3l Target Id GO.11648
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS11952, Molecular Weight 95124.53 Da.
    Residues 839 Isoelectric Point 5.88
    Sequence mepniyqlalaalfgasfvavsgffmhfkalnlvlergkerkenpdgdepqnptlvrrrsqvrrkvndq ygrspaslpdatpftdgggggggdtgrsnghvyvdeippglprlhtpsegrasvhgassirktgsfvrp ispkspvasasafesveesddddnltnsegldasylqangdnempadaneeqismaassmirshsvsgd lhgvqpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwekevis dpstpkpntepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagnir tlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynvrkvdthvhhsacmnqkhllrfiksklrke pdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqd nliqgrflgeitkqvfsdleaskyqmaeyrisiygrkmsewdqlaswivnndlysenvvwliqlprlyn iykdmgivtsfqnildnifiplfeatvdpdshpqlhvflkqvvgfdlvddeskperrptkhmptpaqwt nafnpafsyyvyycyanlyvlnklreskgmttitlrphsgeagdidhlaatfltchsiahginlrkspv lqylyylaqiglamsplsnnslfldyhrnpfpvfflrglnvslstddplqihltkeplveeysiaasvw klsacdlceiarnsvyqsgfshalkshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.34 Rfree 0.323
    Matthews' coefficent 3.28 Rfactor 0.237
    Waters 24 Solvent Content 62.50

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;CF5 (COFORMYCIN) x 1
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2a3l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch