.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a33

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210. Proteins 65 1051-1054 2006
    Site CESG
    PDB Id 2a33 Target Id GO.9733
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30179, Molecular Weight 19221.96 Da.
    Residues 178 Isoelectric Point 5.74
    Sequence meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg rhltgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgihdkpvgllnvdgyy nsllsfidkaveegfisptareiivsaptakelvkklevn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.234
    Matthews' coefficent 1.90 Rfactor 0.181
    Waters 222 Solvent Content 34.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2a33

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch