The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insight into the self-sacrifice mechanism of enediyne resistance. Acs Chem.Biol. 1 451-460 2006
    Site CESG
    PDB Id 1zxf Target Id GO.79751
    Related PDB Ids 2gkd 2gkc 
    Molecular Characteristics
    Source Micromonospora echinospora
    Alias Ids TPS30141,6726 Molecular Weight 17883.22 Da.
    Residues 155 Isoelectric Point 8.13
    Sequence nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqgeehtfglir kvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdrmgtkhakrvrngmdkgwp tilqsfqdkideegakk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1zxf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch