.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of allene oxide cyclase from arabidopsis thaliana AT3G25760. To be published
    Site CESG
    PDB Id 1zvc Target Id GO.15838
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30185, Molecular Weight 27800.04 Da.
    Residues 254 Isoelectric Point 9.11
    Sequence masstislqsismttlnnlsyskqfhrssllgfsksfqnfgissngpgsssptsftpkkkltptralsq nlgntenprpskvqelsvyeindldrhspkilknafsfrfglgdlvpftnklytgdlkkrvgitaglcv viehvpekngdrfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlvyptklf ytfylkglandlpleligtpvppskdvepapeakalkpsgvvsnftn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.79 Rfree 0.283
    Matthews' coefficent 2.40 Rfactor 0.236
    Waters 136 Solvent Content 47.90

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1zvc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch