The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein. Protein Sci. 17 571-576 2008
    Site CESG
    PDB Id 1zr9 Target Id GO.33810
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS30258,6682 Molecular Weight 13168.13 Da.
    Residues 116 Isoelectric Point 8.64
    Sequence mkakrrrpdldeihrelrpqgsarpqpdpnaefdpdlpggglhrclacaryfidstnlkthfrskdhkk rlkqlsvepysqeeaeraagmgsyvpprrlavptevstevpemdtst
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 1zr9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch