The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of allene oxide cyclase from Arabidopsis thaliana at3g25770. To be published
    Site CESG
    PDB Id 1z8k Target Id GO.15839
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30226, Molecular Weight 27633.75 Da.
    Residues 253 Isoelectric Point 6.91
    Sequence massavslqsismttlnnlscnqqfhrssllgssksfqnlgissngsdfsypssftakknltasralsq ngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvv iehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlvyptklfy tfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.71 Rfree 0.18
    Matthews' coefficent 2.90 Rfactor 0.149
    Waters 741 Solvent Content 57.90

    Ligand Information


    Google Scholar output for 1z8k

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch