.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yyc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a putative late embryogenesis abundant (LEA) protein At2g46140.1. To be Published
    Site CESG
    PDB Id 1yyc Target Id GO.9943
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30278,6515 Molecular Weight 17845.39 Da.
    Residues 166 Isoelectric Point 4.53
    Sequence masadekvveekasvisslldkakgffaeklaniptpeatvddvdfkgvtrdgvdyhakvsvknpysqs ipicqisyilksatrtiasgtipdpgslvgsgttvldvpvkvaysiavslmkdmctdwdidyqldiglt fdipvvgditipvstqgeiklpslrdff
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yyc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch