The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structures of the conserved hypothetical proteins from Arabidopsis thaliana gene loci At5g11950 and AT2g37210. Proteins 65 1051-1054 2006
    Site CESG
    PDB Id 1ydh Target Id GO.19912
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30161, Molecular Weight 23773.05 Da.
    Residues 215 Isoelectric Point 5.40
    Sequence mednqrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyegglhvl giipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpgygtmeellemitwsqlgihkktvg llnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekmeeytpshmhvasheswkveelgdy pgqenkpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.213
    Matthews' coefficent 2.49 Rfactor 0.159
    Waters 319 Solvent Content 50.63

    Ligand Information
    Ligands NO3 (NITRATE) x 1;EDO (1,2-ETHANEDIOL) x 4


    Google Scholar output for 1ydh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch