The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CESG
    PDB Id 1ycn Target Id GO.4020
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30191, Molecular Weight 36201.66 Da.
    Residues 317 Isoelectric Point 5.21
    Sequence matlkvsdsvpapsddaeqlrtafegwgtnedliisilahrsaeqrkvirqayhetygedllktldkel sndferaillwtlepgerdallaneatkrwtssnqvlmevactrtstqllharqayharykksleedva hhttgdfrkllvslvtsyryegdevnmtlakqeaklvhekikdkhyndedvirilstrskaqinatfnr yqddhgeeilksleegddddkflallrstiqcltrpelyfvdvlrsainktgtdegaltrivttraeid lkvigeeyqrrnsiplekaitkdtrgdyekmlvallgedda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.51 Rfree 0.268
    Matthews' coefficent 2.87 Rfactor 0.22
    Waters 281 Solvent Content 57.10

    Ligand Information


    Google Scholar output for 1ycn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch