.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xyg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940. To be Published
    Site CESG
    PDB Id 1xyg Target Id GO.9383
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30260, Molecular Weight 39598.48 Da.
    Residues 359 Isoelectric Point 6.50
    Sequence msfrvsasssvkpekdirigllgasgytgaeivrllanhphfqvtlmtadrkagqsmesvfphlraqkl ptlvsvkdadfstvdavfcclphgttqeiikelptalkivdlsadfrlrniaeyeewygqphkavelqk evvyglteilredikkarlvanpgcypttiqlplvpllkanlikheniiidaksgvsgagrgakeanly seiaegissygvtrhrhvpeieqglsdvaqskvtvsftphlmpmirgmqstiyvemapgvrtedlhqql ktsyedeefvkvldegvvprthnvrgsnychmsvfpdripgraiiisvidnlvkgasgqalqnlnimlg ypettgllhqplfp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.19 Rfree 0.208
    Matthews' coefficent 2.14 Rfactor 0.187
    Waters 956 Solvent Content 42.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xyg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch