.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xri

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional characterization of a novel phosphatase from the Arabidopsis thaliana gene locus At1g05000. Proteins 73 241-253 2008
    Site CESG
    PDB Id 1xri Target Id GO.605
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30348, Molecular Weight 24535.96 Da.
    Residues 215 Isoelectric Point 7.62
    Sequence mklvektttteqdngedfcrtiievsevnrnvfqapggeadpfrvvsgeelhlipplnfsmvdngifrs gfpdsanfsflqtlglrsiiylcpepypesnlqflksngirlfqfgiegnkepfvnipdhkirmalkvl ldeknhpvlihckrgkhrtgclvgclrklqkwcltsifdeyqrfaaakarvsdqrfmeifdvssfship msfscsir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.30 Rfree 0.249
    Matthews' coefficent 4.58 Rfactor 0.204
    Waters 60 Solvent Content 73.16

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1xri

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch