.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xq6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structure of Gene Product from Arabidopsis Thaliana At5g02240. To be published
    Site CESG
    PDB Id 1xq6 Target Id GO.23662
    Related PDB Ids 1ybm 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30195, Molecular Weight 27101.48 Da.
    Residues 253 Isoelectric Point 6.20
    Sequence manlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditdadsinpafqg idalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaakvagvkhivvvgsmggtn pdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvgkddellqtdtktvprad vaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvtsrf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2776
    Matthews' coefficent 2.51 Rfactor 0.2183
    Waters 400 Solvent Content 51.00

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals

    Jmol

     
    Google Scholar output for 1xq6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch