.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xo8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a late embryogenesis abundant protein (LEA14) from Arabidopsis thaliana, a cellular stress-related protein. Protein Sci. 14 2601-2609 2005
    Site CESG
    PDB Id 1xo8 Target Id GO.2361
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30315,6339 Molecular Weight 16542.09 Da.
    Residues 151 Isoelectric Point 4.74
    Sequence maslldkakdfvadkltaipkpegsvtdvdlkdvnrdsveylakvsvtnpyshsipiceisftfhsagr eigkgkipdpgslkakdmtaldipvvvpysilfnlardvgvdwdidyelqigltidlpvvgeftipiss kgeiklptfkdff
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xo8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch