.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xmb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of ILL2, an auxin-conjugate amidohydrolase from Arabidopsis thaliana. Proteins 74 61-71 2009
    Site CESG
    PDB Id 1xmb Target Id GO.22207
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30264, Molecular Weight 47853.40 Da.
    Residues 439 Isoelectric Point 6.39
    Sequence malnkllsltfqlllfllsvssespwiaedtsqiqtkllefakspevfdwmvkirrkihenpelgyeel etsklirseleligikyrypvaitgvigyigtgeppfvalradmdalpiqegvewehkskiagkmhacg hdghvtmllgaakilhehrhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgka asragsflagagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretdpldskvvtvskvngg nafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpptvnnkdlykqf kkvvrdllgqeafveaapvmgsedfsyfaetipghfsllgmqdetngyasshsplyrinedvlpygaai hasmavqylkekaskgsvsgfheel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2039
    Matthews' coefficent 2.35 Rfactor 0.1567
    Waters 285 Solvent Content 47.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xmb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch