.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xj5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE OF SPERMIDINE SYNTHASE FROM ARABIDOPSIS THALIANA GENE AT1G23820. To be published
    Site CESG
    PDB Id 1xj5 Target Id GO.3851
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30228, Molecular Weight 36551.52 Da.
    Residues 334 Isoelectric Point 4.72
    Sequence mdaketsatdlkrpreeddnggaatmetengdqkkepacfstvipgwfsemspmwpgeahslkvekvlf qgksdyqdvivfqsatygkvlvldgviqlterdecayqemithlplcsipnpkkvlvigggdggvlrev arhasieqidmceidkmvvdvskqffpdvaigyedprvnlvigdgvaflknaaegsydavivdssdpig pakelfekpffqsvaralrpggvvctqaeslwlhmdiiedivsncreifkgsvnyawtsvptypsgvig fmlcstegpdvdfkhplnpidesssksngplkfynaeihsaafclpsfakkvieskan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.245
    Matthews' coefficent 2.47 Rfactor 0.188
    Waters 576 Solvent Content 50.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xj5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch