The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of the Partially Disordered Protein At2g23090 from Arabidopsis thaliana. To be Published
    Site CESG
    PDB Id 1wvk Target Id GO.7474
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS29828,6432 Molecular Weight 8375.44 Da.
    Residues 78 Isoelectric Point 9.64
    Sequence mgggnaqksamaraknlekakaagkgsqleankkamsiqckvcmqtficttsevkcrehaeakhpkadv vacfphlkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1wvk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch