.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vm9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of T4moC, the Rieske-type ferredoxin component of toluene 4-monooxygenase. Acta Crystallogr.,Sect.D 62 476-482 2006
    Site CESG
    PDB Id 1vm9 Target Id GO.34660
    Molecular Characteristics
    Source Pseudomonas mendocina kr1
    Alias Ids TPS30171, Molecular Weight 12260.97 Da.
    Residues 112 Isoelectric Point 4.38
    Sequence msfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggvitcrahlw tfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.48 Rfree 0.1759
    Matthews' coefficent 2.01 Rfactor 0.1548
    Waters 133 Solvent Content 38.67

    Ligand Information
    Ligands FES (FE2/S2) x 1;EDO (1,2-ETHANEDIOL) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 1vm9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch