The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Arabidopsis At1g77680, 12-oxophytodienoate reductase isoform 1. Proteins 61 206-208 2005
    Site CESG
    PDB Id 1vji Target Id GO.3073
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30352, Molecular Weight 41165.53 Da.
    Residues 372 Isoelectric Point 6.32
    Sequence mengeakqsvplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvsd taqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapiscsdkplmpqir sngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangylidqfmkdtvndrtdeygg slqnrckfpleivdavakeigpdrvgirlspfadymesgdtnpgalglymaeslnkygilychviearm ktmgevhacphtlmpmrkafkgtfisaggftredgneavskgrtdlvaygrwflanpdlpkrfqvdapl nkydrptfytsdpvvgytdypflesta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.293
    Matthews' coefficent 1.86 Rfactor 0.2062
    Waters 107 Solvent Content 33.90

    Ligand Information
    Ligands FMN (FLAVIN) x 1


    Google Scholar output for 1vji

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch